Scaffold Ga0114942_1074294

Overview

Basic Information

• Taxon OID: 3300009527
• Scaffold ID: Ga0114942_1074294
• Source Dataset Name: Groundwater microbial communities from Cold Creek, Nevada to study Microbial Dark Matter (Phase II) - Lower Cold Creek
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1084
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location

• Location Name: Lower Cold Creek, Nevada
• Coordinates
  • Lat. (^o): 36.42
  • Long. (^o): -115.74
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F019851	Metagenome	227	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0114942_10742942	F019851	GAG	VSRASSVPVTEIACHHNKVLATWHADTDDWTYQHRVARKRPTPKQSEQLAQMFDQASAATRRRD*