Scaffold Ga0115004_10000551

Overview

Basic Information

• Taxon OID: 3300009526
• Scaffold ID: Ga0115004_10000551
• Source Dataset Name: Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 28630
• Total Scaffold Genes: 42
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 6 (14.29%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. (ex Stolz et al. 2005) (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean

Source Dataset Sampling Location

• Location Name: Arctic Ocean: Canada Basin
• Coordinates
  • Lat. (^o): 79.2466
  • Long. (^o): -150.0613
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F052252	Metagenome / Metatranscriptome	143	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0115004_1000055139	F052252	N/A	MQDQFINPQQIRSPYTDETVRPTYNTYNANGKTYEQAVMSDPVTGHIIKKGLVSIKDAKTGELIQDYKGALSQSMTTQSRG*