| Basic Information | |
|---|---|
| Taxon OID | 3300009515 Open in IMG/M |
| Scaffold ID | Ga0129286_10090931 Open in IMG/M |
| Source Dataset Name | Microbial community of beach aquifer sediment core from Cape Shores, Lewes, Delaware, USA - CF-2 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Delaware |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 898 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment → Microbial Role In Biogeochemical Cycling In A Beach Aquifer System |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Cape Shores, Lewes, Delaware, USA | |||||||
| Coordinates | Lat. (o) | 38.7855 | Long. (o) | -75.1045 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F105201 | Metagenome | 100 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0129286_100909311 | F105201 | N/A | MLYHDEELDEEELNKCFAKFDSKTIELIQQEYKND* |
| ⦗Top⦘ |