Scaffold Ga0115003_10011549

Overview

Basic Information

• Taxon OID: 3300009512
• Scaffold ID: Ga0115003_10011549
• Source Dataset Name: Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 6149
• Total Scaffold Genes: 18
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 16 (88.89%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean

Source Dataset Sampling Location

• Location Name: Arctic Ocean: Canada Basin
• Coordinates
  • Lat. (^o): 79.2466
  • Long. (^o): -150.0613
  • Depth (m): 25

Associated Families

Family	Category	Number of Sequences	3D Structure?
F007139	Metagenome / Metatranscriptome	357	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0115003_100115492	F007139	AGGA	MITKGIAKYVYLDSTEKFNGEDTGKYTLTVAIDDKEVKALEKAGVKVRTIQTEDGGSYRARKFSTKYPLNFEMIKTDDGEAIGHDFGAESNVEVLWKAGNEHPQHGVATYLTAIKVSNRTEGYKSADSDTNEFFA*