Scaffold Ga0123573_10707632

Overview

Basic Information

• Taxon OID: 3300009509
• Scaffold ID: Ga0123573_10707632
• Source Dataset Name: Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_11
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Beijing Novogene Bioinformatics Technology Co., Ltd
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 947
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment → Mangrove Sediment Microbial Communities From Mai Po Nature Reserve Marshes In Hong Kong, China

Source Dataset Sampling Location

• Location Name: Mai Po Marshes at Hong Kong
• Coordinates
  • Lat. (^o): 22.498889
  • Long. (^o): 114.045833

Associated Families

Family	Category	Number of Sequences	3D Structure?
F099330	Metagenome / Metatranscriptome	103	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0123573_107076322	F099330	GAGG	MSILGEVEEGKMLLGEIREKLNAYIEKINPDDNSLPLDGLHWFISIEADCEDLVGHLSDYNSYDPG*