| Basic Information | |
|---|---|
| Taxon OID | 3300009506 Open in IMG/M |
| Scaffold ID | Ga0118657_10053052 Open in IMG/M |
| Source Dataset Name | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_8 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Novogene |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 6202 |
| Total Scaffold Genes | 7 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 7 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Wetlands → Sediment → Mangrove Sediment → Mangrove Sediment Microbial Communities From Mai Po Nature Reserve Marshes In Hong Kong, China |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Mai Po Nature Reserve Marshes in Hong Kong | |||||||
| Coordinates | Lat. (o) | 22.498889 | Long. (o) | 114.045833 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F044014 | Metagenome | 155 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0118657_100530524 | F044014 | GGAGG | MNDDYKPRFSFEITEEQKLRADRLLATYGLRKAVFGCILDDVLDMIDCYGGVAIGAMMSGKVKPRDIVPSMRKAEEIKDGKP* |
| ⦗Top⦘ |