Scaffold Ga0114946_10010613

Overview

Basic Information

• Taxon OID: 3300009504
• Scaffold ID: Ga0114946_10010613
• Source Dataset Name: Lake sediment microbial communities from Walker lake, Nevada to study Microbial Dark Matter (Phase II) - Walker Lake 11/02/13 Deep Sediment
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 5728
• Total Scaffold Genes: 16
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 11 (68.75%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location

• Location Name: USA: Hawthorne, Nevada
• Coordinates
  • Lat. (^o): 38.7
  • Long. (^o): -118.7
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F098638	Metagenome	103	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0114946_100106138	F098638	N/A	MMMTAREQFEQEHFGIKPAKVGKRYHAAAAWGPSAWRKTLKYWAAFVLGIVLGAIGAGALAVFAGVVR*