Scaffold Ga0123519_10740232

Overview

Basic Information

• Taxon OID: 3300009503
• Scaffold ID: Ga0123519_10740232
• Source Dataset Name: Hot spring microbial communities from Yellowstone National Park - Yellowstone National Park OP-RAMG-02
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 503
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Yellowstone National Park

Source Dataset Sampling Location

• Location Name: USA: Yellowstone National Park
• Coordinates
  • Lat. (^o): 44.61
  • Long. (^o): -110.44

Associated Families

Family	Category	Number of Sequences	3D Structure?
F074155	Metagenome	120	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0123519_107402321	F074155	N/A	EGNHFEGHWQPCNTLAFLKGLGDPALANGRGKALMRVLAKSPNGAEDLGLRARHVKTLIEWEDPPQLRKVLSRISLLLTRMRQRENWLLADYTGNLARKIVAFKLLSKQPISYRLGDAITAHTIEKFGLKTAASDLKVENEDLQLIQQLENITQKPKRPKPTYQTSP