| Basic Information | |
|---|---|
| Taxon OID | 3300009503 Open in IMG/M |
| Scaffold ID | Ga0123519_10388855 Open in IMG/M |
| Source Dataset Name | Hot spring microbial communities from Yellowstone National Park - Yellowstone National Park OP-RAMG-02 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 812 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Yellowstone National Park |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Yellowstone National Park | |||||||
| Coordinates | Lat. (o) | 44.61 | Long. (o) | -110.44 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F008219 | Metagenome | 337 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0123519_103888551 | F008219 | GGAGG | MPKYLIEIILVVEAKNQQEAKNIADYILNLPILDKKIENAIETMRYEEVVQIKNNRA* |
| ⦗Top⦘ |