Scaffold Ga0123519_10357565

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0123519_10357565

Scaffold Ga0123519_10357565

Overview

Basic Information
Taxon OID	3300009503 Open in IMG/M
Scaffold ID	Ga0123519_10357565 Open in IMG/M
Source Dataset Name	Hot spring microbial communities from Yellowstone National Park - Yellowstone National Park OP-RAMG-02
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	867
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Yellowstone National Park

Source Dataset Sampling Location
Location Name	USA: Yellowstone National Park
Coordinates	Lat. (^o)	44.61	Long. (^o)	-110.44	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F046219	Metagenome	151	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0123519_103575652	F046219	GGAGG	LLRRALDLRAALKLGVRIRLDEIRADEFQALVVLEEERDALEREQMQMNAHGR*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.