Scaffold Ga0114930_10511889

Overview

Basic Information

• Taxon OID: 3300009499
• Scaffold ID: Ga0114930_10511889
• Source Dataset Name: Deep subsurface microbial communities from Anholt, Denmark to uncover new lineages of life (NeLLi) - Anholt_01485 metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 540
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface → Deep Subsurface Microbial Communities From Various Oceans To Uncover New Lineages Of Life (Nelli)

Source Dataset Sampling Location

• Location Name: Denmark: Anholt
• Coordinates
  • Lat. (^o): 56.62
  • Long. (^o): 11.67
  • Depth (m): 31

Associated Families

Family	Category	Number of Sequences	3D Structure?
F028081	Metagenome / Metatranscriptome	192	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0114930_105118892	F028081	N/A	LQKTRKENEEAYLKAKAFLDGFRARGKLSQNDSEFLFLLEFVIKGFKNHGNDIIKAFENQVRFTEAFNNLQAKVNDLENEIQQLRITLDKMYRDR*