| Basic Information | |
|---|---|
| Taxon OID | 3300009499 Open in IMG/M |
| Scaffold ID | Ga0114930_10009638 Open in IMG/M |
| Source Dataset Name | Deep subsurface microbial communities from Anholt, Denmark to uncover new lineages of life (NeLLi) - Anholt_01485 metaG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 7359 |
| Total Scaffold Genes | 9 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (55.56%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface → Deep Subsurface Microbial Communities From Various Oceans To Uncover New Lineages Of Life (Nelli) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Denmark: Anholt | |||||||
| Coordinates | Lat. (o) | 56.62 | Long. (o) | 11.67 | Alt. (m) | Depth (m) | 31 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F088271 | Metagenome / Metatranscriptome | 109 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0114930_100096382 | F088271 | N/A | MQKAEIKQIADYLKDLEEGLVEWDYRGITTQGHLTELYQIIKRLMDATYETEDQQLKPLLATLEYKARKCKQCIETRTGVRN* |
| ⦗Top⦘ |