Scaffold Ga0114930_10000622

Overview

Basic Information

• Taxon OID: 3300009499
• Scaffold ID: Ga0114930_10000622
• Source Dataset Name: Deep subsurface microbial communities from Anholt, Denmark to uncover new lineages of life (NeLLi) - Anholt_01485 metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 36680
• Total Scaffold Genes: 32
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 21 (65.62%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface → Deep Subsurface Microbial Communities From Various Oceans To Uncover New Lineages Of Life (Nelli)

Source Dataset Sampling Location

• Location Name: Denmark: Anholt
• Coordinates
  • Lat. (^o): 56.62
  • Long. (^o): 11.67
  • Depth (m): 31

Associated Families

Family	Category	Number of Sequences	3D Structure?
F074333	Metagenome	119	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0114930_1000062223	F074333	GGAG	VKIPTDEKFHPERGHVGKCVWISEDGKAAALQCESSHGGKKNVVFKLRIDS*