| Basic Information | |
|---|---|
| Taxon OID | 3300009494 Open in IMG/M |
| Scaffold ID | Ga0127413_10200223 Open in IMG/M |
| Source Dataset Name | Marine sediment microbial communities from Chincoteague Deepwater methane seep, US Atlantic Margin - Chincoteague Seep MUC-5 12-14 cmbsf |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Oregon State University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 816 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → unclassified Mycoplasmatota → Mycoplasmatota bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Cold Seeps → Sediment → Methane Seep Sediment → Marine Sediment Microbial Communities From Methane Seeps Within Hudson Canyon, Us Atlantic Margin |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Chincoteague Seep, US Atlantic Margin | |||||||
| Coordinates | Lat. (o) | 37.5409 | Long. (o) | -74.10211667 | Alt. (m) | Depth (m) | 1055 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F104458 | Metagenome / Metatranscriptome | 100 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0127413_102002232 | F104458 | N/A | DRRYWEVEYQDGKVINENQMEWRSIPKVNIIRLTLHYDGRRWDIHNKQAYIQKKRASVVPGCGSFTVESRSVGYYEGNKKIFYTVNEFTGQMVMEIKEI* |
| ⦗Top⦘ |