Scaffold Ga0127413_10006337

Overview

Basic Information

• Taxon OID: 3300009494
• Scaffold ID: Ga0127413_10006337
• Source Dataset Name: Marine sediment microbial communities from Chincoteague Deepwater methane seep, US Atlantic Margin - Chincoteague Seep MUC-5 12-14 cmbsf
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Oregon State University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 5178
• Total Scaffold Genes: 11
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 8 (72.73%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Cold Seeps → Sediment → Methane Seep Sediment → Marine Sediment Microbial Communities From Methane Seeps Within Hudson Canyon, Us Atlantic Margin

Source Dataset Sampling Location

• Location Name: Chincoteague Seep, US Atlantic Margin
• Coordinates
  • Lat. (^o): 37.5409
  • Long. (^o): -74.10211667
  • Depth (m): 1055

Associated Families

Family	Category	Number of Sequences	3D Structure?
F065402	Metagenome	127	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0127413_100063378	F065402	AGGAG	MSKQKKVVIGFETSTEFKDKVIKAGKNYKIDEVSSPVNLSMFCRIAVAKLLNEVENKEK*