| Basic Information | |
|---|---|
| Taxon OID | 3300009492 Open in IMG/M |
| Scaffold ID | Ga0127412_10046730 Open in IMG/M |
| Source Dataset Name | Marine sediment microbial communities from Chincoteague Deepwater methane seep, US Atlantic Margin - Chincoteague Seep MUC-5 6-8 cmbsf |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Oregon State University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 534 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Sediment → Unclassified → Unclassified → Methane Seep → Marine Sediment Microbial Communities From Methane Seeps Within Hudson Canyon, Us Atlantic Margin |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | US Atlantic Margin | |||||||
| Coordinates | Lat. (o) | 37.5409 | Long. (o) | -74.10211667 | Alt. (m) | Depth (m) | .06 to .08 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F099148 | Metagenome | 103 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0127412_100467301 | F099148 | AGTAG | MSEHDWLEPLDRRIEQVKEETEAIKRETAALAALHRLYDENGDGMKRLADS* |
| ⦗Top⦘ |