Scaffold Ga0119764_10800287

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0119764_10800287

Scaffold Ga0119764_10800287

Overview

Basic Information
Taxon OID	3300009490 Open in IMG/M
Scaffold ID	Ga0119764_10800287 Open in IMG/M
Source Dataset Name	Microbial community analysis of hydrothermal vent diffuse flow samples from Mid-Cayman Rise, Pacific Ocean - FS852 no min length
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Marine Biological Laboratory
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	521
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Marine Hydrothermal Vent → Microbial Community Analysis Of Hydrothermal Vent Diffuse Flow Samples From Mid-Cayman Rise, Pacific Ocean

Source Dataset Sampling Location
Location Name	Mid-Cayman Rise
Coordinates	Lat. (^o)	18.547101	Long. (^o)	-81.71817	Alt. (m)		Depth (m)	4986
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F079221	Metagenome / Metatranscriptome	116	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0119764_108002871	F079221	GGAGG	MGLQWLQGTNVSARNTWECAFCRRRSRVDRRIVLTIDNGRAGQQRVRCCDLECLRRLLALWEE

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.