Scaffold Ga0114925_11225017

Overview

Basic Information

• Taxon OID: 3300009488
• Scaffold ID: Ga0114925_11225017
• Source Dataset Name: Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00607 metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 551
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium SCGC AG-212-C10 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface → Deep Subsurface Microbial Communities From Various Oceans To Uncover New Lineages Of Life (Nelli)

Source Dataset Sampling Location

• Location Name: near North Sumatra
• Coordinates
  • Lat. (^o): 1.759
  • Long. (^o): 96.774
  • Depth (m): 1855

Associated Families

Family	Category	Number of Sequences	3D Structure?
F018939	Metagenome / Metatranscriptome	232	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0114925_112250171	F018939	N/A	MFKHPNYYKELRKLRNKLDQAISETKPTGDGERAPGPGLKHQA