| Basic Information | |
|---|---|
| Taxon OID | 3300009483 Open in IMG/M |
| Scaffold ID | Ga0127651_108962 Open in IMG/M |
| Source Dataset Name | Microbial communities of aphids from Rhus glabra galls in Chiricahua Mtns, AZ, USA - Melaphis rhois NM090294 seqcov |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Texas, Austin |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 5935 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (25.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Insecta → Unclassified → Unclassified → Unclassified → Rhus Glabra → Host-Associated Microbial Communities Of Aphids From Plants In Several Locations Around Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Chiricahua Mtns, AZ, USA | |||||||
| Coordinates | Lat. (o) | 31.934752 | Long. (o) | -109.3828 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F013193 | Metagenome | 273 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0127651_1089624 | F013193 | N/A | MHQHRP*TLEAPKEVIAQEVAAIPPEMTRKVIDNYRETLDRCIENEGRHLSDVIFKNS* |
| ⦗Top⦘ |