Scaffold Ga0127522_131949

Overview

Basic Information

• Taxon OID: 3300009477
• Scaffold ID: Ga0127522_131949
• Source Dataset Name: Microbial communities of aphids from Cirsium sp. in Ottawa, Ontario, CA - Brachycaudus cardui CNC#HEM061370 seqcov
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Texas, Austin
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1751
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Insecta → Unclassified → Unclassified → Unclassified → Cirsium Sp. → Host-Associated Microbial Communities Of Aphids From Plants In Several Locations Around Usa

Source Dataset Sampling Location

• Location Name: Ottawa, Ontario, CA
• Coordinates
  • Lat. (^o): 45.4516
  • Long. (^o): -75.68045

Associated Families

Family	Category	Number of Sequences	3D Structure?
F029983	Metagenome	186	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0127522_1319491	F029983	N/A	MSLCCTVGYKWVTVMDDIKFEFIDIISLYTKNDSEWRRFVSQGYVILY*