Scaffold Ga0127390_1109148

Overview

Basic Information

• Taxon OID: 3300009474
• Scaffold ID: Ga0127390_1109148
• Source Dataset Name: Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 3m depth; DNA IDBA-UD
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Marine Biological Laboratory
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 725
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Campylobacteraceae → Campylobacter → Campylobacter coli (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond → Aquatic Microbial Communities From Different Depth Of Meromictic Siders Pond, Falmouth, Massachusetts

Source Dataset Sampling Location

• Location Name: Falmouth, Massachusetts
• Coordinates
  • Lat. (^o): 41.548517
  • Long. (^o): -70.622961
  • Depth (m): 3

Associated Families

Family	Category	Number of Sequences	3D Structure?
F031456	Metagenome / Metatranscriptome	182	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0127390_11091481	F031456	N/A	MALIGSFPASSSAVFNLDFLPEKFLVQGPQSDQSLTNFSVVCSGVQLMSITDVARLNALAKFDSGAILNNPTAATVNSAAAYLRLATGRINKATTITGTNGIASVRSVYAASTNIGNIARRAVEQSINPSANATFDNFEALIFDSTNILRAQVTFANGYTDEYTEVELRALYSNYHVSEEFGFVNGLITIDADSGAGLIS