Scaffold Ga0127520_1028733

Overview

Basic Information

• Taxon OID: 3300009473
• Scaffold ID: Ga0127520_1028733
• Source Dataset Name: Microbial communities of aphids from lettuce in Tucson, AZ, USA - Acyrthosiphon lactucae NM052899 seqcov
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Texas, Austin
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 4336
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Kalotermitidae → Cryptotermitinae → Cryptotermes → Cryptotermes secundus (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Insecta → Unclassified → Unclassified → Unclassified → Lettuce → Host-Associated Microbial Communities Of Aphids From Plants In Several Locations Around Usa

Source Dataset Sampling Location

• Location Name: Tucson, AZ, USA
• Coordinates
  • Lat. (^o): 32.23184
  • Long. (^o): -110.950699

Associated Families

Family	Category	Number of Sequences	3D Structure?
F029983	Metagenome	186	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0127520_10287331	F029983	N/A	VAK*MSLCCTVDYKWVAVMDGVKFEFNNIVSLYKKNGQ