Scaffold Ga0126447_1085411

Overview

Basic Information

• Taxon OID: 3300009470
• Scaffold ID: Ga0126447_1085411
• Source Dataset Name: Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, surface; DNA IDBA-UD
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Marine Biological Laboratory
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 771
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond → Aquatic Microbial Communities From Different Depth Of Meromictic Siders Pond, Falmouth, Massachusetts

Source Dataset Sampling Location

• Location Name: Falmouth, Massachusetts
• Coordinates
  • Lat. (^o): 41.548517
  • Long. (^o): -70.622961
  • Depth (m): .5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F063622	Metagenome / Metatranscriptome	129	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0126447_10854112	F063622	GAGG	MKLHEQLTEWYYIHNAVQSGGVIANEIVNVVKDWLKTHHREETKYDADYNAGW