| Basic Information | |
|---|---|
| Taxon OID | 3300009469 Open in IMG/M |
| Scaffold ID | Ga0127401_1166612 Open in IMG/M |
| Source Dataset Name | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 6m depth; DNA IDBA-UD |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Marine Biological Laboratory |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 551 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond → Aquatic Microbial Communities From Different Depth Of Meromictic Siders Pond, Falmouth, Massachusetts |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Falmouth, Massachusetts | |||||||
| Coordinates | Lat. (o) | 41.548517 | Long. (o) | -70.622961 | Alt. (m) | Depth (m) | 6 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F021732 | Metagenome / Metatranscriptome | 217 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0127401_11666121 | F021732 | N/A | MNITKYTVKCCLDKKRQHFVHVIFSSGFGLYGANKPHHEDDNIEIHGWTFEPHDIDLKLYPNINRFNLM |
| ⦗Top⦘ |