Basic Information | |
---|---|
Taxon OID | 3300009466 Open in IMG/M |
Scaffold ID | Ga0126448_1029796 Open in IMG/M |
Source Dataset Name | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 2m depth; DNA IDBA-UD |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Marine Biological Laboratory |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1289 |
Total Scaffold Genes | 5 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (40.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond → Aquatic Microbial Communities From Different Depth Of Meromictic Siders Pond, Falmouth, Massachusetts |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Falmouth, Massachusetts | |||||||
Coordinates | Lat. (o) | 41.548517 | Long. (o) | -70.622961 | Alt. (m) | Depth (m) | 2 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F063769 | Metagenome / Metatranscriptome | 129 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0126448_10297964 | F063769 | N/A | MIATCGGEVHYTLDSDSGRSEWSGMGGWMHASHAMNLATRNPTQGGPYTACWTGNRSCGCCEANGCINFFPAGIPGQGPTPCDQVRDHAHKGGNGLLRIQFLSDTGVYNLDATG* |
⦗Top⦘ |