Basic Information | |
---|---|
Taxon OID | 3300009448 Open in IMG/M |
Scaffold ID | Ga0114940_10056960 Open in IMG/M |
Source Dataset Name | Groundwater microbial communities from Cold Creek, Nevada to study Microbial Dark Matter (Phase II) - Cold Creek Source |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1747 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (25.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Cold Creek Source, Nevada | |||||||
Coordinates | Lat. (o) | 36.41 | Long. (o) | -115.74 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F087385 | Metagenome | 110 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0114940_100569602 | F087385 | AGG | LISKSGGDLLSQGVYPQVPSAQAVLTSVFGMGTGVTLPL* |
⦗Top⦘ |