| Basic Information | |
|---|---|
| Taxon OID | 3300009434 Open in IMG/M |
| Scaffold ID | Ga0115562_1191469 Open in IMG/M |
| Source Dataset Name | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 737 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine → Pelagic Marine Microbial Communities From North Sea |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Germany:Helgoland, sampling site Kabeltonne, North Sea | |||||||
| Coordinates | Lat. (o) | 54.1883 | Long. (o) | 7.9 | Alt. (m) | Depth (m) | 1 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F009845 | Metagenome / Metatranscriptome | 312 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0115562_11914691 | F009845 | AGG | VFIFGKIKTYIIGALALALPIIYVMGKVRGSANEKNKVLKDDLQAQQKATDFYKKMAEHENDNITDRKSLTKRLRGNGL* |
| ⦗Top⦘ |