| Basic Information | |
|---|---|
| Taxon OID | 3300009432 Open in IMG/M |
| Scaffold ID | Ga0115005_11525393 Open in IMG/M |
| Source Dataset Name | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 547 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Eukaryotic Phytoplankton Communities From The Norwegian Sea, Arctic And Atlantic Ocean |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Arctic Ocean | |||||||
| Coordinates | Lat. (o) | 79.0225 | Long. (o) | -9.5247 | Alt. (m) | Depth (m) | 17 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F051476 | Metagenome / Metatranscriptome | 144 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0115005_115253932 | F051476 | N/A | MIMTYWKAKLIIKNKLHKTELFESVERARLWSMKEAKLTVSHRMFNHTDIVTEITSHKFA |
| ⦗Top⦘ |