Basic Information | |
---|---|
Taxon OID | 3300009432 Open in IMG/M |
Scaffold ID | Ga0115005_10247340 Open in IMG/M |
Source Dataset Name | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1395 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Eukaryotic Phytoplankton Communities From The Norwegian Sea, Arctic And Atlantic Ocean |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Arctic Ocean | |||||||
Coordinates | Lat. (o) | 79.0225 | Long. (o) | -9.5247 | Alt. (m) | Depth (m) | 17 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F077929 | Metagenome | 117 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0115005_102473404 | F077929 | GGA | MKWLLVLISINLYDDGTADHFVFTNMMYENLQSCLATAQLNMKTIEEVSIREFNSPAKVYCFREDKFKQYLQTQPKSEPKKLNI* |
⦗Top⦘ |