Scaffold Ga0114915_1005297

Overview

Basic Information

• Taxon OID: 3300009428
• Scaffold ID: Ga0114915_1005297
• Source Dataset Name: Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 5207
• Total Scaffold Genes: 16
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 13 (81.25%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location

• Location Name: South Georgia Island
• Coordinates
  • Lat. (^o): -50.35
  • Long. (^o): -39.82
  • Depth (m): 4

Associated Families

Family	Category	Number of Sequences	3D Structure?
F046007	Metagenome / Metatranscriptome	152	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0114915_100529710	F046007	AGGAG	MTQYLNEILAGKERMSEEKLDKLPTSLYRHKTKDEDYWLTRFASGRTVKEFADKRKKDEVTYGKS*