Basic Information | |
---|---|
Taxon OID | 3300009425 Open in IMG/M |
Scaffold ID | Ga0114997_10009559 Open in IMG/M |
Source Dataset Name | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 6987 |
Total Scaffold Genes | 13 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 9 (69.23%) |
Novel Protein Genes | 2 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Associated Families | 2 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → unclassified Parcubacteria group → Parcubacteria group bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Arctic Ocean: Canada Basin | |||||||
Coordinates | Lat. (o) | 75.235 | Long. (o) | -150.0691 | Alt. (m) | Depth (m) | 79 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F015360 | Metagenome / Metatranscriptome | 255 | Y |
F019253 | Metagenome / Metatranscriptome | 231 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0114997_100095591 | F015360 | N/A | IGLLYWYNMTKAKMDYLWAPKDEKLVSSLLDSLGFIKVGESRRYPTGVKYDALVAICDVISSQEKMASMVASRTHELQASRKATGKAPSIDSVVAALASGKMSEADLKKAMKLAGLI* |
Ga0114997_100095594 | F019253 | AGGAG | MNPVEKFNKFMTQHTDKVPLLSVESTDDKRFTVLREFLSSSFENVEDNAWSVSQNLGKFIDALSTMEPQDIRKITNTVRKYEVKGDNFGIRGEGKYGYDRSRVDRALIRRKRAN* |
⦗Top⦘ |