Scaffold Ga0114998_10260658

Overview

Basic Information

• Taxon OID: 3300009422
• Scaffold ID: Ga0114998_10260658
• Source Dataset Name: Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 816
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean

Source Dataset Sampling Location

• Location Name: Arctic Ocean: Canada Basin
• Coordinates
  • Lat. (^o): 75.235
  • Long. (^o): -150.0691
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F072751	Metagenome	121	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0114998_102606581	F072751	N/A	HDESRMWLMNNAEIYHVKELISVCEFNKLQLIERALGSPFSEFSTEECDELFERIEVQLKDLEDHLESIRLKNQKIKDELGDDWLKEKH*