NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0114994_10271428

Scaffold Ga0114994_10271428


Overview

Basic Information
Taxon OID3300009420 Open in IMG/M
Scaffold IDGa0114994_10271428 Open in IMG/M
Source Dataset NameMarine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1133
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Marine Group I → Marine Group I thaumarchaeote(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean

Source Dataset Sampling Location
Location NameArctic Ocean: Canada Basin
CoordinatesLat. (o)73.2247Long. (o)-150.2247Alt. (m)Depth (m)67
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005832Metagenome / Metatranscriptome389Y
F049035Metagenome147Y

Sequences

Protein IDFamilyRBSSequence
Ga0114994_102714281F049035GAGGMANWNSNELQTPDAIKKIGQNAQNVINNLDILLKIVKGGANVAKLFLLLSNPAGAIIKLAADEIIKAANDFKEIGVFYLFINPNDDGYGNQTTRELGLAIKRDGLTGLYQFKPTVLSAGSPGSTTTFTVGKAYQKSLDIADLDSNYVDSNGRTKADSILFSAGKNFIPPIPIFDDPPEWVLGGYDPSTWTGHAPITSIPLADGSFP
Ga0114994_102714282F005832GGTGGMSKEGLWQDSKGMKDSEIVKKWTKTLHTVEYAMEQLKYQKTALMKKKEDIVNSEETKNG*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.