Basic Information | |
---|---|
Taxon OID | 3300009420 Open in IMG/M |
Scaffold ID | Ga0114994_10109849 Open in IMG/M |
Source Dataset Name | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1875 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Arctic Ocean: Canada Basin | |||||||
Coordinates | Lat. (o) | 73.2247 | Long. (o) | -150.2247 | Alt. (m) | Depth (m) | 67 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F056139 | Metagenome / Metatranscriptome | 138 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0114994_101098493 | F056139 | N/A | MIEVNPYLTWEYCTDPEIQYLDCPAPEPMRNHMPEWFKKLKGKKDEVTFAEQQTIRNCLGFRGLANIGYTIPLPEDLDGYDTYFSRGRVSAPMVDGTLFGNKGDKPWASDDTSLYEYRFKILNYPWRAKMAKGWRLLILPYLLDWNNDWNEFAGTVEPNYDVQHGRQIGSSLKWTTPIDTQYNYYNLETVVAYKRSLLKMEKGTLTFCAVPLFDPELLDKQTKGVYNDNMD* |
⦗Top⦘ |