Scaffold Ga0114902_1117578

Overview

Basic Information

• Taxon OID: 3300009413
• Scaffold ID: Ga0114902_1117578
• Source Dataset Name: Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s12
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 697
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Gimesia → unclassified Gimesia → Gimesia sp. (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location

• Location Name: Mediterranean Sea
• Coordinates
  • Lat. (^o): 39.48
  • Long. (^o): 6.37
  • Depth (m): 2851

Associated Families

Family	Category	Number of Sequences	3D Structure?
F022083	Metagenome / Metatranscriptome	216	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0114902_11175782	F022083	N/A	MLLQAIGFIAAMVYGYGQLNARLQFIEHQSNMNGQTLKEMKAMQNLPIPSDVRQDEKLRRIEEEIARLRDGKGN*