| Basic Information | |
|---|---|
| Taxon OID | 3300009410 Open in IMG/M |
| Scaffold ID | Ga0114955_1014086 Open in IMG/M |
| Source Dataset Name | Marine algal microbial communities from Porto, Portugal - Porto_5 metaG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2787 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Rhodophyta → Bangiophyceae → Bangiales → Bangiaceae → Porphyra → Porphyra umbilicalis | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Algae → Red Algae → Unclassified → Unclassified → Marine → Genome And Metagenome Analysis Of Marine Red Algae Porphyra |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Portugal: Porto | |||||||
| Coordinates | Lat. (o) | 41.162 | Long. (o) | -8.622 | Alt. (m) | Depth (m) | 2 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F066406 | Metagenome | 126 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0114955_10140863 | F066406 | GAGG | VGTASEPSTWASKLLVTQLVFLARGAFPRSTPCVCALRDLLPGRVFPDRTTRRHGLARLTPISVGLAGLVVTFGGAAGEEGDSTFLGAVAVRQLASGGT* |
| ⦗Top⦘ |