Scaffold Ga0116587_1064513

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0116587_1064513

Scaffold Ga0116587_1064513

Overview

Basic Information
Taxon OID	3300009406 Open in IMG/M
Scaffold ID	Ga0116587_1064513 Open in IMG/M
Source Dataset Name	Microbial communities from sediment of the River Tyne Estuary, UK ? Pasteurized_176d_1 SPAdes
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Liverpool
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	626
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment → Anaerobic Oil Degrading Microbial Communities From River Tyne Estuarine Sediment

Source Dataset Sampling Location
Location Name	United Kingdom
Coordinates	Lat. (^o)	54.9632021	Long. (^o)	-1.6348029	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F096823	Metagenome	104	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0116587_10645131	F096823	AGTAG	MKKALTFLMMTIMMVAVTTTISQTHKVYAENKAKDLCSQYDGEWNNGKCKIKNDEDKTDYEDELCDDPKDTKKYPKICKNN*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.