Scaffold Ga0103853_1000056

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0103853_1000056

Scaffold Ga0103853_1000056

Overview

Basic Information
Taxon OID	3300009404 Open in IMG/M
Scaffold ID	Ga0103853_1000056 Open in IMG/M
Source Dataset Name	Microbial communities of water from Amazon river, Brazil - RCM6
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	University of Georgia
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	6551
Total Scaffold Genes	12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (16.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water → Aquatic Microbial Communities From Amazon River, Brazil And North Atlantic Ocean

Source Dataset Sampling Location
Location Name	Amazon river
Coordinates	Lat. (^o)		Long. (^o)		Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F068923	Metagenome / Metatranscriptome	124	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0103853_10000561	F068923	N/A	QGNPADFWRSFGSLADRDPANAWRYLNQASANPEVFRQKLLVME*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.