Basic Information | |
---|---|
Taxon OID | 3300009402 Open in IMG/M |
Scaffold ID | Ga0103742_1045527 Open in IMG/M |
Source Dataset Name | Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 4B |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | J. Craig Venter Institute (JCVI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 570 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica → Eukaryotic And Microbial Communities From Ice Edge, Mcmurdo Sound, Antarctica |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Ice edge, McMurdo Sound, Antarctica | |||||||
Coordinates | Lat. (o) | -77.36 | Long. (o) | 164.28 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F012120 | Metatranscriptome | 283 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0103742_10455271 | F012120 | N/A | LADIHNPEAVQFMLDFIYEVDDAASWKDYNPKTQEINKDVLRLASNFRLPGLTERAAFWLAKDLTTGNVVERLTICEDFELGDLRERILAQLATNKKALFEVAHSPQIMKYPSLMQSLLQQAAGVPEESPQPKKKARLQK* |
⦗Top⦘ |