Scaffold Ga0103742_1031218

Overview

Basic Information

• Taxon OID: 3300009402
• Scaffold ID: Ga0103742_1031218
• Source Dataset Name: Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 4B
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: J. Craig Venter Institute (JCVI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 685
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica → Eukaryotic And Microbial Communities From Ice Edge, Mcmurdo Sound, Antarctica

Source Dataset Sampling Location

• Location Name: Ice edge, McMurdo Sound, Antarctica
• Coordinates
  • Lat. (^o): -77.36
  • Long. (^o): 164.28

Associated Families

Family	Category	Number of Sequences	3D Structure?
F082735	Metatranscriptome	113	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0103742_10312181	F082735	GGA	MAMKLATSVVLAALFSSADASALRNQGAATSVMSAEELKKTLLEEIQNDFASVGKNGRLARLEAALKPLFDSLPKNQHGNLGHSPVRYALHRVFVQRHGWYIKGLEPDGDAWNTTSPAGVLKDKVSSYVEELFEERLGGRGFNLHDTAVLAATLEHLIHDDSKDRLTKAYAAKRSSTETALTRAQADA