| Basic Information | |
|---|---|
| Taxon OID | 3300009400 Open in IMG/M |
| Scaffold ID | Ga0116854_1012679 Open in IMG/M |
| Source Dataset Name | Soil microbial community of the Robinson Ridge, Antarctica. Combined Assembly of Gp0139162, Gp0138857, Gp0138858 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Queensland |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1422 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (25.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Thermogemmatisporales → Thermogemmatisporaceae → Thermogemmatispora → Thermogemmatispora tikiterensis | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Community Of The Robinson Ridge, Antarctica |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Robinson Ridge, Antarctica | |||||||
| Coordinates | Lat. (o) | -66.369451 | Long. (o) | 110.585574 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F023564 | Metagenome / Metatranscriptome | 209 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0116854_10126793 | F023564 | AGGAG | MSNRAFEVGDRVRVIESLFQREAASIDGAIGTVRSVDKDRRRTEPYYIYYIELPGEAKLIDFEYRELELVSPANV* |
| ⦗Top⦘ |