Scaffold Ga0116854_1007649

Overview

Basic Information

• Taxon OID: 3300009400
• Scaffold ID: Ga0116854_1007649
• Source Dataset Name: Soil microbial community of the Robinson Ridge, Antarctica. Combined Assembly of Gp0139162, Gp0138857, Gp0138858
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Queensland
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1533
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Community Of The Robinson Ridge, Antarctica

Source Dataset Sampling Location

• Location Name: Robinson Ridge, Antarctica
• Coordinates
  • Lat. (^o): -66.369451
  • Long. (^o): 110.585574

Associated Families

Family	Category	Number of Sequences	3D Structure?
F084576	Metagenome	112	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0116854_10076492	F084576	N/A	MPDPDARPVDTKRWRLAVVRHLEDLPRQYAALEHAMATFGADFDLQQFKDAYNTAEDMDAYNRVQAVERALGRVQNYVAELADAGVKLAGVPRPKDSHGSPAQQAFEAMRDAKVINSSLCRRLVQAQNARTRIEHSYVQTPAGDVHRAAILVRDAARDFMGSYRAWIEPFLT*