Scaffold Ga0103752_1003343

Overview

Basic Information

• Taxon OID: 3300009392
• Scaffold ID: Ga0103752_1003343
• Source Dataset Name: Microbial communities of red sea marine sponge, Stylissa carteri from the coast of Thuwal, Saudi Arabia - rep 2
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Wuerzburg
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2482
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Porifera → Demospongiae → Heteroscleromorpha → Haplosclerida → Niphatidae → Amphimedon → Amphimedon queenslandica (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Microbial Communities Of Red Sea Marine Sponge, Stylissa Carteri From The Coast Of Thuwal, Saudi Arabia

Source Dataset Sampling Location

• Location Name: coast of Thuwal, Saudi Arabia
• Coordinates
  • Lat. (^o): 22.23
  • Long. (^o): 39.03

Associated Families

Family	Category	Number of Sequences	3D Structure?
F038110	Metagenome / Metatranscriptome	166	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0103752_10033432	F038110	N/A	MCPMVEVCSPAKVDDPESLAISIRDVSYKLMNLKIILLLIHCLVDMPTSQARLSYLVMSERYRIVRVMVSEHRGATLLVSH*