| Basic Information | |
|---|---|
| Taxon OID | 3300009385 Open in IMG/M |
| Scaffold ID | Ga0103852_1000166 Open in IMG/M |
| Source Dataset Name | Microbial communities of water from Amazon river, Brazil - RCM5 |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Georgia |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 4208 |
| Total Scaffold Genes | 11 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (18.18%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water → Aquatic Microbial Communities From Amazon River, Brazil And North Atlantic Ocean |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Amazon river | |||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F002739 | Metagenome / Metatranscriptome | 533 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0103852_10001667 | F002739 | AGGAG | MPKGAKKVTAGGEKHIVYKKTSPTGIGKGKKGHIMVNHPTINKGEWDTIDLTQKAKAKTVKQGIAATKKWHKENPYPKFKKK* |
| ⦗Top⦘ |