Scaffold Ga0103868_1000625

Overview

Basic Information

• Taxon OID: 3300009384
• Scaffold ID: Ga0103868_1000625
• Source Dataset Name: Microbial communities of water from Amazon river, Brazil - RCM21
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Georgia
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1991
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water → Aquatic Microbial Communities From Amazon River, Brazil And North Atlantic Ocean

Source Dataset Sampling Location

• Location Name: Amazon river
• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F090382	Metagenome / Metatranscriptome	108	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0103868_10006251	F090382	GGA	MIRIDPSLNPLEVLIVADRLKEKGVQSYSLIPGNECIWAYYGVINEYYIFRDGRLVDVQID*