| Basic Information | |
|---|---|
| Taxon OID | 3300009362 Open in IMG/M |
| Scaffold ID | Ga0118673_1067178 Open in IMG/M |
| Source Dataset Name | Syntrophic microbial communities from biogas reactors - R1.C13.But.A IBDA |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Molecular Research LP (MR DNA) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1073 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Latescibacteria → unclassified Candidatus Latescibacteria → Candidatus Latescibacteria bacterium ADurb.Bin168 | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Wastewater Sludge → Syntrophic Microbial Communities From Biogas Reactors In Seattle, Wa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Seattle, WA | |||||||
| Coordinates | Lat. (o) | 47.652555 | Long. (o) | -122.304991 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F010099 | Metagenome / Metatranscriptome | 308 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0118673_10671782 | F010099 | N/A | MTNSQTSFWTPARIGAVIGVVLLIVALAYLVSLPQNQFAPADLLEPKYAADADLGYWMVYEYDQEVDVYHLLVVMQHDNGTFEWLEGDGIWLPRRAVEGTFTVIGSFDRRKANL* |
| ⦗Top⦘ |