Scaffold Ga0118672_1163700

Overview

Basic Information

• Taxon OID: 3300009360
• Scaffold ID: Ga0118672_1163700
• Source Dataset Name: Syntrophic microbial communities from biogas reactors in Seattle, WA - R1.C12.But.B IBDA
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Molecular Research LP (MR DNA)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 544
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Wastewater Sludge → Syntrophic Microbial Communities From Biogas Reactors In Seattle, Wa

Source Dataset Sampling Location

• Location Name: Seattle, WA
• Coordinates
  • Lat. (^o): 47.652555
  • Long. (^o): -122.304991

Associated Families

Family	Category	Number of Sequences	3D Structure?
F054066	Metagenome / Metatranscriptome	140	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0118672_11637001	F054066	N/A	GKGSPGLKAVMYRMLNKPYLDIRIYRGYREVTRIVTPDKGMRRFVVDEVGAFVMPNEEQMLRQLHDRYALYINYNINSSAPGQVTEELEPIAFTYPPLSPAEFQTELEAQTVADLLAETEKDNSWIWLLAGGAVLIFIMILIFGGA*