| Basic Information | |
|---|---|
| Taxon OID | 3300009360 Open in IMG/M |
| Scaffold ID | Ga0118672_1063064 Open in IMG/M |
| Source Dataset Name | Syntrophic microbial communities from biogas reactors in Seattle, WA - R1.C12.But.B IBDA |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Molecular Research LP (MR DNA) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1020 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (60.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Wastewater Sludge → Syntrophic Microbial Communities From Biogas Reactors In Seattle, Wa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Seattle, WA | |||||||
| Coordinates | Lat. (o) | 47.652555 | Long. (o) | -122.304991 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F054898 | Metagenome / Metatranscriptome | 139 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0118672_10630641 | F054898 | N/A | LNIEELPAGYRCRVCGRRFSTEEAAFVHQSYDCVRPVRGMVEE* |
| ⦗Top⦘ |