| Basic Information | |
|---|---|
| Taxon OID | 3300009325 Open in IMG/M |
| Scaffold ID | Ga0116603_113435 Open in IMG/M |
| Source Dataset Name | Processed tobacco microbial communities from USA domestic dry snuff from retail store in Atlanta, GA, USA - Dry Snuff D1 2x mi-seq runs combined |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Centers for Disease Control and Prevention (CDC), USA |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 885 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Cordycipitaceae → Beauveria → Beauveria bassiana → Beauveria bassiana D1-5 | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Engineered → Food Production → Unclassified → Unclassified → Unclassified → Processed Fermented Consumer Product → Processed Tobacco Microbial Communities From Usa Domestic Dry Snuff |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Georgia, USA | |||||||
| Coordinates | Lat. (o) | 33.733333 | Long. (o) | -84.383333 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F062378 | Metagenome / Metatranscriptome | 130 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0116603_1134351 | F062378 | GAGG | MAASKPISLSTQIKTFLISLNNNFGTLTFVLGCFPFDIQPYH |
| ⦗Top⦘ |