Scaffold Ga0116593_1002274

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0116593_1002274

Scaffold Ga0116593_1002274

Overview

Basic Information
Taxon OID	3300009308 Open in IMG/M
Scaffold ID	Ga0116593_1002274 Open in IMG/M
Source Dataset Name	Microbial communities from sediment of the River Tyne Estuary, UK ? Pasteurized_686d_3 SPAdes
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Liverpool
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	6203
Total Scaffold Genes	13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	11 (84.62%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment → Anaerobic Oil Degrading Microbial Communities From River Tyne Estuarine Sediment

Source Dataset Sampling Location
Location Name	United Kingdom
Coordinates	Lat. (^o)	54.9632021	Long. (^o)	-1.6348029	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F006143	Metagenome	380	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0116593_10022744	F006143	AGG	MQEENPIEEKKTPTTKFAEWLMARAEKKEAKETSLESLMKFNVFLSIATLVSVAGATVADYVLMAWLWI*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.